PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009772448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 292aa    MW: 32574.3 Da    PI: 10.1616
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009772448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-3874133261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +e++lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+
  XP_009772448.1  74 PETILKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNNKR 133
                     67899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3062127IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3277132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.37678132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAFSSIPIYL DPPNWQHEQG NHQRQPGVAN ESPSQLSPAM LPPPAVGGGG GGPAGSVRPG  60
SMVERARLTK VTQPETILKC PRCESTNTKF CYFNNYSLSQ PRHFCKTCRR YWTRGGALRN  120
VPVGGGCRRN NKRGTKRSRS KSPTRSEKRN CPIITSANAT TSTNSIPHLP HPTHLSFLST  180
TNLHNFSDFT STENSLNFGG SQPQDGTRDQ MDVQARFIDQ FRFQQMQQFP FFSTLEQQPS  240
NNLYQFEAAA EYHVGEVANV KVEVNKGTNS QGLNLPRNNL GVTNNQFWTN FH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772448.10.0PREDICTED: dof zinc finger protein DOF3.6-like
RefseqXP_016491280.10.0PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLM1C5E87e-94M1C5E8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000602162e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.13e-40OBF-binding protein 3